SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|40804657|ref|NP_955636.1|NC_005311 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|40804657|ref|NP_955636.1|NC_005311
Domain Number 1 Region: 29-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.88e-20
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|40804657|ref|NP_955636.1|NC_005311
Sequence length 135
Comment putative thioredoxin protein [Bacillus licheniformis plasmid pFL5]
Sequence
MNKKWIIIFVIIFAACLAFVIFFQSNSNSAQAHENIDLNEYQEKINKKQNFIIYIYSPTC
ATCEEFAPTLNATIQDTKTKVYSLNVSEINNNKKVFLEKQSIEVTPSLIKYKNGKEQDRR
IGNIPEKELKEFLKK
Download sequence
Identical sequences Q70JC3
gi|40804657|ref|NP_955636.1|NC_005311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]