SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410503649|ref|YP_006941054.1|NC_019012 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410503649|ref|YP_006941054.1|NC_019012
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily CheY-like 6.49e-37
Family CheY-related 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410503649|ref|YP_006941054.1|NC_019012
Sequence length 227
Comment Transcriptional regulatory protein cusR [Fibrella aestuarina BUZ 2 plasmid pFAES01]
Sequence
MKLLLVEDEAKLNTFIDRGLTEEGHRVDTAYDGQIGLSMALDGDYDVVILDVNLPILNGF
QVCQRLRVEKPNVPVLMLTALGSMTHKKEGYGAGADDYLVKPFEFDELLLRVQALYKRYR
EVGAHRVLQVADLELNVGTKQVQRAGQLISLTAREYALLEYLMLNKGRIVSRVDIAEKVW
ELNFDTNTNVIDVYVNYLRRKVDKGFEQKLIHTVVGMGYVMKDPTTR
Download sequence
Identical sequences I0KHM2
gi|410503649|ref|YP_006941054.1| gi|410503649|ref|YP_006941054.1|NC_019012 WP_015056805.1.89626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]