SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410592462|ref|YP_006952259.1|NC_019057 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|410592462|ref|YP_006952259.1|NC_019057
Domain Number - Region: 142-250
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000137
Family Thioltransferase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410592462|ref|YP_006952259.1|NC_019057
Sequence length 258
Comment conjugal transfer pilus assembly protein TraF [Escherichia coli plasmid pHK01]
Sequence
MMKEKMMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEP
DIMQKLAALQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPEL
DYNLQYSHYNGTVRNQLAADQAQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRD
TYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMMLVDPKQGSVRPLSYGFISQ
DDLAKQFLNVSEDFKPNF
Download sequence
Identical sequences A0A0U3HII5 B8XWR7 D2U5W5 F4SMY4 G7QEE9
gi|219586116|ref|YP_002456210.1|NC_011812 gi|283826903|ref|YP_003377774.1|NC_013727 gi|410592462|ref|YP_006952259.1|NC_019057 gi|410609384|ref|YP_006953343.1|NC_019071 gi|410609483|ref|YP_006953441.1|NC_019072 gi|410609788|ref|YP_006953968.1|NC_019090 gi|410683207|ref|YP_006940277.1|NC_018998 gi|429339568|ref|YP_006990780.1|NC_019424 gi|451770754|ref|YP_007447566.1|NC_020278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]