SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410678385|ref|YP_006930756.1|NC_018878 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|410678385|ref|YP_006930756.1|NC_018878
Domain Number - Region: 20-104
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00159
Family Hypothetical protein VC1899 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410678385|ref|YP_006930756.1|NC_018878
Sequence length 225
Comment NERD domain protein [Bacillus thuringiensis Bt407 plasmid BTB_502p]
Sequence
MELFLFIGSFVLTFLFVTVTLYLLLNRWNYHDSTYKDITGFHYKNINQDKSILAEWKIFR
RLEKSFPDSMLLANVHIPYQDGQTNDIDIVLIHSSGVYPIECQTLKGKVYGSDKSKEWVQ
WITAKNKYQFPNPLSKNKQCTRFLSQYLSLPYEGLTPLIVFGKETLTVKVKLSSSTKAKV
IQVDDIEKTIRNLIKDSSPVLTTKDMKGIYQKLSLFTSISNTHKQ
Download sequence
Identical sequences A0A0F6J8M1
gi|410678385|ref|YP_006930756.1| gi|410678385|ref|YP_006930756.1|NC_018878 WP_000418703.1.23360 WP_000418703.1.84541 WP_000418703.1.8577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]