SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410684236|ref|YP_006060243.1|NC_017589 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410684236|ref|YP_006060243.1|NC_017589
Domain Number 1 Region: 137-201
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 5.78e-17
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0039
Further Details:      
 
Domain Number 2 Region: 18-115
Classification Level Classification E-value
Superfamily CheY-like 0.0000000226
Family CheY-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410684236|ref|YP_006060243.1|NC_017589
Sequence length 226
Comment Negative regulator of exopolysaccharide production two-component transcription regulator protein [Ralstonia solanacearum CMR15 plasmid CMR15_mp]
Sequence
MVRAGATHVLQSLPAVSQVISVEPDEALFENLAAHADAELALIGLPLPGIDDIPALTRLM
QQPHPRHIAVLGESDSPAHVRAVMQLNISAYLLRSYAGKLIAAALELVLAGGRYVPASVV
LARSDMPLGANRAGHDDCALLGLTQRQYEILVLLSRGHPVKTISRMLGISEATTKAHINA
LYRRLEVRSRTEAVFVATQRGAMLMSHPRLVEATAYTATARLARTG
Download sequence
Identical sequences D8NGE0
gi|410684236|ref|YP_006060243.1|NC_017589 gi|410684236|ref|YP_006060243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]