SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|42761464|ref|NP_976259.1|NC_005562 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|42761464|ref|NP_976259.1|NC_005562
Domain Number - Region: 30-70
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0628
Family KorB DNA-binding domain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|42761464|ref|NP_976259.1|NC_005562
Sequence length 72
Comment hypothetical Pep I protein [Acidianus ambivalens plasmid pDL10]
Sequence
MNKQKLEKFANLELDLLSVLLSLSDDDVDNLINELENILQKYKEKAIETDVLQLLNKLSD
EEKRKLIEKLLK
Download sequence
Identical sequences O57698
gi|42761464|ref|NP_976259.1|NC_005562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]