SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314563|ref|YP_007151010.1|NC_019761 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428314563|ref|YP_007151010.1|NC_019761
Domain Number - Region: 14-102
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00322
Family TnsA endonuclease, N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428314563|ref|YP_007151010.1|NC_019761
Sequence length 222
Comment TnsA endonuclease [Microcoleus sp. PCC 7113 plasmid pMIC7113.04]
Sequence
MPSGAARARKITNAGNRKVIGKFPSLKMNAVIWWESQLERDYIYLLEIDPEVLSYGEQPF
TISYTDKGKPRRYTPDFVVTRPQKTQVVEVKPSNQAQTEKNLNLFRKIAPICTANNQEFV
VVTELRIRVQPRLNNIKLLYRYARVPLSLSNYLDCLQYFHSTEPICLLNAERDLKERGIN
RSLMLRLLWCGFLVTDLMQPINAESLIRLSKEAPSWERLKIQ
Download sequence
Identical sequences K9WRR3
gi|428314563|ref|YP_007151010.1| gi|428314563|ref|YP_007151010.1|NC_019761 WP_015211557.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]