SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434380295|ref|YP_006624730.1|NC_018516 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|434380295|ref|YP_006624730.1|NC_018516
Domain Number - Region: 87-176
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00706
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434380295|ref|YP_006624730.1|NC_018516
Sequence length 210
Comment hypothetical protein BTF1_30387 [Bacillus thuringiensis HD-789 plasmid p01]
Sequence
MITDRLKNTVNNWNNVKGYKLRENNQDIKKSLKARGYTLLDCDFPKIVFTPVTKQVYDKV
GCNEVYGVVESDYGLDIVKLENVSVPTTFEAIEQIEHKYQDVVSKNTISFEISVEAYKQM
IQYSKTVTENIKQVKEELEETQKQSFAFQEHVDVLTELLKDCNAEKKELLETILGVIKEE
NKTPVENYQTLLVRIEEVAKSLQNKEVVAD
Download sequence
Identical sequences A0A0B5NKN4 A0A0Q9FI81 A0A0Q9GDE7 A0A160LIF7 A0A242YKU6 A0A2C9Z4H9 C3GTK2 Q3EYY5
gi|434380295|ref|YP_006624730.1| gi|434380295|ref|YP_006624730.1|NC_018516 WP_000627136.1.100059 WP_000627136.1.101838 WP_000627136.1.23615 WP_000627136.1.26459 WP_000627136.1.38325 WP_000627136.1.42217 WP_000627136.1.44348 WP_000627136.1.52284 WP_000627136.1.60526 WP_000627136.1.87705 WP_000627136.1.97830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]