SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|440685371|ref|YP_007160163.1|NC_019774 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|440685371|ref|YP_007160163.1|NC_019774
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-32
Family ArsC-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|440685371|ref|YP_007160163.1|NC_019774
Sequence length 118
Comment ArsC family protein [Anabaena cylindrica PCC 7122 plasmid pANACY.04]
Sequence
MSIQVYGIPNCGTCKKAFKWLQDNGIDYEFINTKETPPTREMIQNWVKSLGSAAMRNTSG
QSYRALGDDKKTWTDEQWIEAFANDAMLLKRPLFLLDGTAVLIGFKDKAEVVRQKLGL
Download sequence
Identical sequences K9ZQ91
gi|440685371|ref|YP_007160163.1| gi|440685371|ref|YP_007160163.1|NC_019774 WP_015217854.1.27213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]