SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46562271|ref|YP_009177.1|NC_005863 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46562271|ref|YP_009177.1|NC_005863
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily CheY-like 2.28e-24
Family CheY-related 0.0012
Further Details:      
 
Domain Number 2 Region: 147-213
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000442
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46562271|ref|YP_009177.1|NC_005863
Sequence length 215
Comment response regulator [Desulfovibrio vulgaris str. Hildenborough plasmid pDV]
Sequence
MLPVDPSPARADLRFLLIDDHPAVRQGLNLLLESHGYTPGVEAATRADAKGCLEQATFDL
ALLDLSLADGSGLDLLADLAEHGVRILVYSMHEDPGTIDRALRCGANGYVTKREDPSVLL
EGIEGVLRGERFVSERAGSSLDETAGARAMDPLFLLSDQERAIFSAVGRGESNMDVAGSL
GISPRTVETYLARMVNKLGLSNVRTLRKFAINWRE
Download sequence
Identical sequences A0A0E0T7L7 Q72WF2
gi|46562271|ref|YP_009177.1| WP_011176714.1.14085 YP_009177.1.77684 gi|387134027|ref|YP_005704017.1| 882.DVUA0137 gi|387134027|ref|YP_005704017.1|NC_017311 gi|46562271|ref|YP_009177.1|NC_005863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]