SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|472434018|ref|YP_007618171.1|NC_020562 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472434018|ref|YP_007618171.1|NC_020562
Domain Number 1 Region: 155-288
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.09e-22
Family DsbC/DsbG C-terminal domain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 47-98
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.00000000902
Family DsbC/DsbG N-terminal domain-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|472434018|ref|YP_007618171.1|NC_020562
Sequence length 290
Comment hypothetical protein G432_20720 [Sphingomonas sp. MM-1 plasmid pISP1]
Sequence
MSVTDRLRSLTWRSRLLVATVTGLSLAGIALAADASSAEDRVRALLKTRLPKTPVTAIDC
GKVGGLCEITAGENLFYVDSGARYLVIGRVYDMQTRQDITAARLLEMNPDMLVGSAARAN
ALARGGEEEGAQQLAAAPARVERPVASAQAHKLSLSGLPREGAIVWGNPSGQTVTVFSDF
RCGYCRALTGVLKDMNVRVVERPISVLGSRDVADRVYCARNREAALHAAYAGEPIKAGPA
CNTSGLDANEAFARRHGLSGTPVIVRGDGAVLEGYRPRAFLEKWLKEAQS
Download sequence
Identical sequences M4S7V6
gi|472434018|ref|YP_007618171.1| gi|472434018|ref|YP_007618171.1|NC_020562 WP_015460519.1.78711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]