SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|492085032|ref|WP_005742448.1|NZ_CM000959 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|492085032|ref|WP_005742448.1|NZ_CM000959
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 8.2e-21
Family ParB-like nuclease domain 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|492085032|ref|WP_005742448.1|NZ_CM000959
Domain Number - Region: 120-202
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00288
Family KorB DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|492085032|ref|WP_005742448.1|NZ_CM000959
Sequence length 312
Comment putative partitioning protein [Pseudomonas syringae pv. lachrymans str. M301315 plasmid pMPPla107]
Sequence
MTSLADQIKEKSLAAQYSGISKTIDEQPRQGEEIVDLDPSRVDPNPFQYRIRFNIETVED
LGKKIRRNGQMQPIGVRKAGDRYQIIWGEHRWRACTLEKLRVKAIVREATDEEMASLCFG
ENNDRSNPTAFEDYNAIAIQRRLGRKGKEIQEELGIRSQDFYKLLGFDNFPESVLSLVKL
NLDVIGKTEAEALGKLFSGAGDNTQKVTDVVLEAIDRFVNKNLPTRKAMLEFIQKELKVS
TPKTPRQAKTATQAIETKKPPATLMFEGKPVGTYENGEAGVCVIVSKEDLAQDKFEELQQ
FLASFFEIKKED
Download sequence
Identical sequences A0A0N0G863
gi|492085032|ref|WP_005742448.1|NZ_CM000959 WP_005742448.1.26784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]