SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|516015956|ref|WP_017446539.1|NZ_AMRX01000008 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|516015956|ref|WP_017446539.1|NZ_AMRX01000008
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily CheY-like 1.57e-28
Family CheY-related 0.0022
Further Details:      
 
Domain Number 2 Region: 89-173
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000251
Family FIS-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|516015956|ref|WP_017446539.1|NZ_AMRX01000008
Sequence length 177
Comment hypothetical protein [Gayadomonas joobiniege G7 plasmid pG7]
Sequence
MAKILIIEDEISFSQILCKRLNRHGHQCFQVASMEAAFAQIIDISPDAVVLDMKLGEQNS
LLQLPKLRQKLPAAKIILLTGFASIATAVEAIKAGADDYLAKPVATQALLKLLFDDSDMN
STGGEQTEDIIPSPARVEWEHIQQVLKLNQGNISQTARQLGMHRRTLQRKLLKKPAR
Download sequence
Identical sequences gi|516015956|ref|WP_017446539.1|NZ_AMRX01000008 WP_017446539.1.28635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]