SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|521251401|ref|YP_008146218.1|NC_021654 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|521251401|ref|YP_008146218.1|NC_021654
Domain Number 1 Region: 90-188
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000811
Family Thioltransferase 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|521251401|ref|YP_008146218.1|NC_021654
Sequence length 200
Comment trbB [Klebsiella pneumoniae plasmid pKN-LS6]
Sequence
MLKPKKRRKPVKNSLKNLAKTPLAALALSLALAGMAHAGTLDEVKSLWDPQGISGTETAS
PQSSTPQAVSGASQPRWLRLSNGKQVDLRDWKVVLFMQGHCPYCHKFDPVLKQLAGQYGF
SVFSYTIDGQGDDAFPEALPAPPDVMQTFFPNIPVATPTTFLVNVNTLAAYPILQGATDA
QGFMARVDTVFQMMENPNNG
Download sequence
Identical sequences G9G2I9
gi|410656356|ref|YP_006958878.1|NC_019155 gi|521251401|ref|YP_008146218.1|NC_021654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]