SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55978317|ref|YP_145373.1|NC_006462 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55978317|ref|YP_145373.1|NC_006462
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000379
Family Glutathione peroxidase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55978317|ref|YP_145373.1|NC_006462
Sequence length 131
Comment hypothetical protein TTHB134 [Thermus thermophilus HB8 plasmid pTT27]
Sequence
MVRLRKPLPPYALKTPEGGKVYLPDLKGKPLVLLRSEALAQGLAAREAELKALEAQAYLL
AQAPRPSPLPLLLDPEGALLGAIPEGGVLVADAFLEVYHLGPVRDEEEVLEWLRFVEAQC
PECVLPEADWL
Download sequence
Identical sequences Q53W32
300852.TTHB134 YP_145373.1.19876 gi|55978317|ref|YP_145373.1|NC_006462 gi|55978317|ref|YP_145373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]