SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55978356|ref|YP_145412.1|NC_006462 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55978356|ref|YP_145412.1|NC_006462
Domain Number 1 Region: 8-138
Classification Level Classification E-value
Superfamily CheY-like 2.85e-28
Family CheY-related 0.0011
Further Details:      
 
Domain Number 2 Region: 156-216
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000195
Family ROK associated domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|55978356|ref|YP_145412.1|NC_006462
Sequence length 217
Comment response regulator [Thermus thermophilus HB8 plasmid pTT27]
Sequence
MDGFLVKPAQALIVEDDRRVAALHRAFLEEEGLRVGGIAGTLREAWAFLEENPDLVLLDL
YLPDGHGLELLPALEGVYTVVITAARDVPTVERALLGGAMDYLVKPFGRSRLREALARFR
AFQNLKAKKEVSQADVDRLLGRRQAPKGLDPLTLGRVLALLQGGKPLTAEEVAEALGLSR
VTAWRYLEALRREGRVRAEPRYGGTGRPSRAYRLEPH
Download sequence
Identical sequences Q53VZ6
gi|55978356|ref|YP_145412.1| 300852.TTHB173 YP_145412.1.19876 ttk003001074.1 gi|55978356|ref|YP_145412.1|NC_006462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]