SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56709054|ref|YP_165099.1|NC_006569 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56709054|ref|YP_165099.1|NC_006569
Domain Number 1 Region: 63-230
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.72e-23
Family Glutathione peroxidase-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56709054|ref|YP_165099.1|NC_006569
Sequence length 236
Comment hypothetical protein SPOA0270 [Ruegeria pomeroyi DSS-3 plasmid megaplasmid]
Sequence
MRKRFLLSGLTLVAAATVVGWQVWSPVPPARPSPMSSVFEASDAYQFDPPAPGSYRLNRI
KRAPDGRVLDIAGTEHSLHDLTRGKISLVSFVYLTCGDVNGCPLAMSVFFDVHDASGDLP
GLNEDVQLLTISFDPARDTVEAIEAFAYPITSDEQAGDKLNWQVLTTSGPQELRPILDGY
GQVVDRSEDQETISHLLRLFLVDRQGDIRNVYGLGFLDPRLLLTDIETLLMEEAGA
Download sequence
Identical sequences Q5LKV9
246200.SPOA0270 gi|56709054|ref|YP_165099.1| gi|56709054|ref|YP_165099.1|NC_006569 WP_011242049.1.46818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]