SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571046060|ref|YP_008996648.1|NC_023285 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571046060|ref|YP_008996648.1|NC_023285
Domain Number 1 Region: 137-238
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 6.24e-24
Family PhoB-like 0.0013
Further Details:      
 
Domain Number 2 Region: 18-194
Classification Level Classification E-value
Superfamily CheY-like 1.57e-18
Family CheY-related 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|571046060|ref|YP_008996648.1|NC_023285
Sequence length 252
Comment Putative response regulator [Streptomyces sp. F8 plasmid pFRL5]
Sequence
MTPEERWPPAGGPDDGSSPPLLLAEPDEELAAQAMARFTAAGVRVVACHDGAEALLQAGA
HHPGAVLLAAPLPVVDAAAVTALIGRLSPVPVIVGAGPDGAKEATEALAAGAVAFVARPY
RIEEIFPLLTAGMMKRGDGSADTLVVGDIELDPAGFHVFVKGRSLQLPVREFMLLRYLMQ
HANRLVSRSELTQALWGTENPESNTLTVHVRRIRSRLREGGGSCCTIDAIRGMGYRLECS
KTARSTVQQSSH
Download sequence
Identical sequences V9Z929
gi|571046060|ref|YP_008996648.1|NC_023285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]