SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|574093232|ref|YP_008998016.1|NC_023315 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|574093232|ref|YP_008998016.1|NC_023315
Domain Number 1 Region: 294-455,562-614,748-850
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.87e-17
Family ABC transporter ATPase domain-like 0.039
Further Details:      
 
Domain Number 2 Region: 5-100,143-256
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000049
Family PHP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|574093232|ref|YP_008998016.1|NC_023315
Sequence length 893
Comment ATPase [Escherichia coli plasmid pEQ011]
Sequence
MKGSEWNKWDLHIHSPMTWQANGYSSQCDIVHYVHLLREKQLSLIAVTNYFYFRQNELET
IREEIARQGLNITVLGNVEFRLDQQNKAGDFINVHILFSDKVSTERINEALARVPLRLTD
GDRKAIYCCEKSVTESGHGVDTIVVDFSALLGHLSSAFRPFKDYLVAVCPNGYGGYRPDA
SGRSAAIATEIDRQGQIIFGGKGDREFFLRTNRYDGASIKPVFLCSDAHRVEDIGSRYTW
VKALPTFEGLRQALLEPEDRLRLGDEWLTELTPKTHFSQIDLEGTIFDGQEIRFKKLSIP
LNQDMVAIIGGRGTGKSLLLDALRSRFAGTATRGSEQREVNVQYLSIELDKANGEKMRFD
APSEGYEYLHVSQGEIKKLCQEPGLISDEIKKMLRLTPIHEAGDTVAQLAENLNIWRAWR
EFSLYRNEHSEPVNTRKFQQQIIRGAQEKIEVLTSDRNKALIETFRENSRRQTLLVQMRD
KLTGVRADITTAENNLNASIAAINASVTTKEAIPLVDLSAQTEAVACRLLSIQEQTTQFG
RDNDEIIGTFREQGLGQDITGLLEKVHEYQRQMELAETHLHEIERRERQYQTGLEQRAKV
AAEFIDGLLSRQSVIDTAFASLTTKPHLTQDQQTLIKDILTDIRIYGKPHFDIKAFYEGM
LSCLNRGRFRASGELTSVDRLRQVFRVGSIDDFRALLANKPMLVLPEFSNRKVTIEEFLW
CDEYFNSPGPDSLLSYLFSPEQIQRYLNVRAEFEYKGKTVEKLSAGQRGTFYVCLKLATD
AFGSPFVFDQPEDDLDNDFIMHSLVPLFRKIKQYRQVIIVTHNANLVVNCDAEQVIIATN
NDEIISYRSGALEYGDHDAPNSMRKAICDVLEGGHQAFEAREQKYGMLWLKTI
Download sequence
Identical sequences W0FXX3
gi|574093232|ref|YP_008998016.1|NC_023315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]