SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|76803438|ref|YP_327707.1|NC_007427 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76803438|ref|YP_327707.1|NC_007427
Domain Number 1 Region: 33-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000251
Family Vacuolar sorting protein domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76803438|ref|YP_327707.1|NC_007427
Sequence length 193
Comment hypothetical protein NP6160A [Natronomonas pharaonis DSM 2160 plasmid PL131]
Sequence
MTSTYIKTKPERCCMTEDESDSEGLMERQTTGEDRVRMVARQLSEPQTANWIASEAGWSH
EPTKRVLERLVDDGILHCDESGTHTTYYPDYRRQAMQEAMRLRDSGHTVEELTDRLADMK
TQIRDWEDEFGVESPNQLRGTLADESLDGGEEDRRRDIAREWEHLQRRIQIVGFAIREWD
FLAPTTEPAEASS
Download sequence
Identical sequences Q3IM08
gi|76803438|ref|YP_327707.1|NC_007427 WP_011324459.1.57290 348780.NP6160A gi|76803438|ref|YP_327707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]