SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|86360806|ref|YP_472693.1|NC_007766 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86360806|ref|YP_472693.1|NC_007766
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily CheY-like 0.000000000000108
Family CheY-related 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|86360806|ref|YP_472693.1|NC_007766
Sequence length 134
Comment two-component response regulator protein [Rhizobium etli CFN 42 plasmid p42f]
Sequence
MQRPFSFAGRFYLIVEDEYLAASSMVMALEDAGAEVAGPVSNVAGALKLVSERASKFEAA
ILDINLRGTMAHPAAERLAEEGIPFVVVTGYDCGSVPEPFSMMPCLNKPCDEQELLTVLA
GLPVRRRPGLHRSI
Download sequence
Identical sequences Q2JZM0
gi|86360806|ref|YP_472693.1| 347834.RHE_PF00073 gi|86360806|ref|YP_472693.1|NC_007766 WP_011428383.1.62937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]