SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94313377|ref|YP_586586.1|NC_007974 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94313377|ref|YP_586586.1|NC_007974
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily CheY-like 0.00000000000586
Family CheY-related 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94313377|ref|YP_586586.1|NC_007974
Sequence length 136
Comment response regulator receiver domain-containing protein (CheY-like) [Cupriavidus metallidurans CH34 plasmid megaplasmid]
Sequence
MISRTNTDRLTVYLVERTPSVRRRQLRLLASLDGLRVAGAGHDAQAHQTELVDLQPDVVL
IGLNATENTPLPRIRALAIALPASTLIVLANEGTPQMRRACLMAGVAHCFDKTLEIVELR
NLLLAMASTARQHRQR
Download sequence
Identical sequences A0A132HQY0 Q1LEV9
WP_011518921.1.12480 WP_011518921.1.25839 WP_011518921.1.481 WP_011518921.1.52493 WP_011518921.1.66126 266264.Rmet_4452 gi|94313377|ref|YP_586586.1|NC_007974 gi|94313377|ref|YP_586586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]