SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94314250|ref|YP_587459.1|NC_007974 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94314250|ref|YP_587459.1|NC_007974
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily CheY-like 1.71e-37
Family CheY-related 0.0002
Further Details:      
 
Domain Number 2 Region: 122-219
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 6.52e-29
Family PhoB-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94314250|ref|YP_587459.1|NC_007974
Sequence length 225
Comment transcriptional regulator two components regulatory system [Cupriavidus metallidurans CH34 plasmid megaplasmid]
Sequence
MRILLVDDDQKAARLLARGLQEEGYDVETAHSVDVAAAHNCYAFSLLILDWMLPGKSGVE
FCRELREQGVRTPILMLTARDAINDRITGLDTGADDYLTKPFVFEELLAHVRALLRRVEL
AQPAPITLNDLVIDPQTRGVTRAGARLDLTPKEYAILILLVTHAGEIVSRAQLAEHIWHA
DLIAIDNLIDVHMKNLRRKLDPPGMAALIQTVRGQGFRISPSGAL
Download sequence
Identical sequences Q1LCD6
gi|94314250|ref|YP_587459.1| WP_011519733.1.12480 WP_011519733.1.25839 266264.Rmet_5331 gi|94314250|ref|YP_587459.1|NC_007974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]