SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|10956358|ref|NP_052807.1|NC_001496 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10956358|ref|NP_052807.1|NC_001496
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily Anthrax protective antigen 2.48e-40
Family Anthrax protective antigen 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|10956358|ref|NP_052807.1|NC_001496
Sequence length 204
Comment pXO1-111 [Bacillus anthracis plasmid virulence plasmid PX01]
Sequence
MNILVRDPYHYDNNGNIVGVDDSYLKNAYKQILNWSSDGVSLNLDEDVNQALSGYMLQIK
KPSNHLTNSPVTITLAGKDSGVGELYRVLSDGTGFLDFNKFDENWRSLVDPGDDVYVYAV
TKEDFNAVTRDENGNIANKLKNTLVLSGKIKEINIKTTNINIFVVFMFIIYLLFYIISST
VFAKSCNCILIYVEVSQLMNSVFY
Download sequence
Identical sequences D8HA88
gi|10956358|ref|NP_052807.1|NC_001496 gi|301068195|ref|YP_003786966.1|NC_014331 gi|301068195|ref|YP_003786966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]