SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|182676966|ref|YP_001831113.1|NC_010580 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182676966|ref|YP_001831113.1|NC_010580
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-52
Family Methylesterase CheB, C-terminal domain 0.0000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|182676966|ref|YP_001831113.1|NC_010580
Sequence length 327
Comment CheB methylesterase [Beijerinckia indica subsp. indica ATCC 9039 plasmid pBIND01]
Sequence
MSQRDIIAIGGSLGAVEAVKNLFRDLPPGIDATILIVIHVGTVGNNYLADIFDEEASIPV
TMARDGEKLKRGHAYVAPADHHLLVMGNHIRLGRGPRENMARPAIDPLFRSIAVSHGSRT
VAVVLTGLLNDGAAGLADVKRCGGVTVVQNPREATAPQMPLEALKTGYVDYIIPLEELGN
LLKKLTKEEAGQSNEIPEGLLFEVEIALGYKTGIKKNAKIADVVPLSCPACGGVLSQLKI
GLPLRFRCQTGHAYTAETLINVKEGAVDEALRVALRMIEERVFLCEKMAEDARRSDRHAA
AKIAEERMQEYKDYADLLRRTLLGKNY
Download sequence
Identical sequences B2ILH1
WP_012382982.1.21334 gi|182676966|ref|YP_001831113.1| gi|182676966|ref|YP_001831113.1|NC_010580 395963.Bind_3836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]