SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288402|ref|YP_002223688.1|NC_011255 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288402|ref|YP_002223688.1|NC_011255
Domain Number 1 Region: 77-370
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 1.83e-47
Family Variable surface antigen VlsE 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|203288402|ref|YP_002223688.1|NC_011255
Sequence length 378
Comment vlp protein [Borrelia recurrentis A1 plasmid pl35]
Sequence
MYVLYKSYFFASNPSKKSYKKAKKKKNKEAKRMKKGIKGEMINIVMIMCLMVVMGCNSGG
VKGEEGKGTQGIGGLGEVISHLREGFLEVFVSFGNILKDTFGLTSNTTKKEVGERLGKIG
EAVEIAKGKLEGIKGTEQFSLMKDKVDSVITNAVNILKKLVEGTKKFKEATDGANGKIGN
ANGTEDAVQADIASVKSLVEGINMIYEAAKEVKVDSKGNADKTIADSKAIAKLFNDTASA
DATGLKAANVALNSSSGADILAAIDSAKNGINAPAGQISAAKNAYDIAVAIKNSADAGAD
VREKGSVITAGLALRAMAKNGKLATHANVPAEGLNAVLIGAVSKTVNEIVSTIRRTVDKC
LKDVNDCIKEGFSSVVKS
Download sequence
Identical sequences B5RS56
412418.BRE_4003 gi|203288402|ref|YP_002223688.1| WP_012539610.1.6979 gi|203288402|ref|YP_002223688.1|NC_011255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]