SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|206575407|ref|YP_002235619.1|NC_011281 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206575407|ref|YP_002235619.1|NC_011281
Domain Number 1 Region: 6-102,129-245
Classification Level Classification E-value
Superfamily PHP domain-like 2.35e-23
Family PHP domain 0.0071
Further Details:      
 
Domain Number 2 Region: 277-421,753-854
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.94e-19
Family ABC transporter ATPase domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|206575407|ref|YP_002235619.1|NC_011281
Sequence length 895
Comment hypothetical protein KPK_B0082 [Klebsiella pneumoniae 342 plasmid pKP91]
Sequence
MTVGSRWFKFDFHNHTPASDDYRVPDLQPREWLLAYMRQQVDCVVISDHNSGAWVDVLKA
ELANMYRDASSGELADFRPLTLFPGVELTATGNVHILAVLHTKSTSAEVERLLAQCNNNC
PISRETPNHQLVLQLGPAGIISNIRRNPEAICILAHIDAAKGVLTSLTNQGELTAAFQSK
PHAVEIRHREEDITNGTHRRLIADLPWLRGSDAHHPEQAGARTCWLKMSAPDFDGLRHAL
LDPENCVLFDDNPPEAPASHLRSLTFRTRLCKPVDQNGASVEFSPFYNAVIGSRGSGKST
LIESIRLAMRKTEGLTASQINKLNLFSQTGMGMDTDSFIECVFHKEGTDFRLSWRPGGCH
ELHIFSEGQWVQDNHWSADRFPLSIYSQKMLYELASDTGAFLRVCDESPMVNKRAWKERW
DQLERDYLNEQITLRGHLASQTIAGKLQGELSDAERAISQLRSSAYYPVCTRLATARAEL
SAATLPLDHNEQRVAALRAQEKEPVQVPELQVESSAPLTAFMTRLLDVQQKYDQRLDTLL
SDYAAELRTIKQEPPFLALEEAVRNQEETVQREAMVLREQGLNPDVLDELMTRSESLKSE
LRNYADLDGTIAASAARSKGLLAEMRNHRMVLTEKRKAFLSSLSLSALEIKILPLCAPHE
DTVSGYQAVTGIGNFADRIYDNGDGSGLLHDFISLRPYSPLPSATENKYLALDTLKALHL
AIHREEPGVGAELHGAFRNRLKGLNEAQLDALQCWYPDDGIHIRYQTPGGGMEDISSASP
GQKGASMLQFLLSYGTDPLLLDQPEDDLDCLMLSMSVIPAIMANKKRRQLIIVSHSAPIV
VNGDAEYVISMQHDRSGLYPGLCGALQETLVKELICRQMEGGEKAFRSRYERILS
Download sequence
Identical sequences B5RKN8
WP_012539971.1.6018 gi|206575407|ref|YP_002235619.1| 507522.KPK_B0082 gi|206575407|ref|YP_002235619.1|NC_011281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]