SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226357780|ref|YP_002787520.1|NC_012528 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226357780|ref|YP_002787520.1|NC_012528
Domain Number 1 Region: 308-512
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.96e-22
Family Pancreatic carboxypeptidases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226357780|ref|YP_002787520.1|NC_012528
Sequence length 602
Comment hypothetical protein Deide_3p00810 [Deinococcus deserti VCD115 plasmid 3]
Sequence
MELLSALRLAHQPHHVLAYVSESPQTRAALRTSIVRAAGPGCAARVRSAYKTAYFWITEE
VQPLWRRAQADRVTLTYPVLSEAPQGRFLQEAYPLAAVFEREGVEAEFVPGPVGRPYYQA
TLWRGERELWHGTCFTPLFQRQAPDGRMVLGPTGWLTVQAEGADVLDQRLETDGEAFWDW
YVATVLPAVLELADRRDDGLVFRNLAVTLQLSEPDLALDVLDERISMTEALTEEVYFGTV
DALKRHTSTPPGARTLTPGRIVPVAHAVPGQDGWARVTLTEWASSPAELHRPGASHSVTA
DPESVLQDRPAPPGQIWANARAAADRHQLEWHVPAHSVDGRPVPAVLRSTPGAAGSVLIT
AGQHANETTGPVAALNLLSHLAGMPVNFALLPLENPDGAFLHRALTQLAPNHMHHAARYT
SLGDDLEARLRQGDRRWEAGARAWAQEQVGANLHLNLHGYPAHEWVRPYSGYAPHGFESW
ALPAGFITIVWYWPGHDKPARLLAEAIAQRLQQEPEVVQHAQAALRASTAHVLTPHYELI
GGLPFILTEQPSALCPLTVITEAPDETIYGARFRSCVQAHLSVCLAAIGHTLRGDGQPES
CT
Download sequence
Identical sequences 546414.Deide_3p00810 gi|226357780|ref|YP_002787520.1| gi|226357780|ref|YP_002787520.1|NC_012528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]