SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269958222|ref|YP_003328010.1|NC_013531 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269958222|ref|YP_003328010.1|NC_013531
Domain Number 1 Region: 1-71
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.89e-18
Family Thioltransferase 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269958222|ref|YP_003328010.1|NC_013531
Sequence length 81
Comment glutaredoxin-like protein NrdH [Xylanimonas cellulosilytica DSM 15894 plasmid pXCEL01]
Sequence
MSITVYSKPACVQCEATYRALDKKGLEYTVVDITQDATALETVRALGYLQAPVVVTEVTH
WSGFRPDQINALALAQGTPTP
Download sequence
Identical sequences D1C0Y6
gi|269958222|ref|YP_003328010.1| 446471.Xcel_3453 WP_012880192.1.53538 gi|269958222|ref|YP_003328010.1|NC_013531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]