SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298501414|ref|YP_003723411.1|NC_014249 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298501414|ref|YP_003723411.1|NC_014249
Domain Number - Region: 172-209
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00184
Family Rho termination factor, N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298501414|ref|YP_003723411.1|NC_014249
Sequence length 218
Comment hypothetical protein Aazo_5288 ['Nostoc azollae' 0708 plasmid pAzo01]
Sequence
MSAIITNYRQLDVAFLLLNNLRIKLRTAGVRISVRKVGNVHRITVSKQPTVATIEQIVGA
TNAKTETRNLSSNNAISSPTEITSSTDDTRSENGANIAPTVNKEIEDNSVVKVITETLSE
STSPLDESHTGYSKDIICDNTAEIITNSTNFPTPAYSSLEITNISDSPELANLENLQTLT
LKRLRKLAKLHKVPGFSRMKEEKLVTKLHGLAIKELVL
Download sequence
Identical sequences D7E5M9
gi|298501414|ref|YP_003723411.1| gi|298501414|ref|YP_003723411.1|NC_014249 WP_013193297.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]