SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301068197|ref|YP_003786968.1|NC_014331 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301068197|ref|YP_003786968.1|NC_014331
Domain Number 1 Region: 44-764
Classification Level Classification E-value
Superfamily Anthrax protective antigen 1.31e-275
Family Anthrax protective antigen 3.37e-18
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301068197|ref|YP_003786968.1|NC_014331
Sequence length 764
Comment protective antigen [Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1]
Sequence
MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA
PMVVTPSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV
DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL
QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH
EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPSVHVDMENIIL
SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST
VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL
ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD
TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS
DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNV
TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI
DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN
PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG
Download sequence
Identical sequences A0A2H2X3I7 D8HA90
gi|301068197|ref|YP_003786968.1| gi|301068197|ref|YP_003786968.1|NC_014331 WP_000746484.1.28913 WP_000746484.1.31503 WP_000746484.1.51335 WP_000746484.1.6340 WP_000746484.1.71895 WP_000746484.1.7398 WP_000746484.1.7628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]