SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302595334|ref|YP_003829049.1|NC_014382 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302595334|ref|YP_003829049.1|NC_014382
Domain Number 1 Region: 307-468,575-627,761-863
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-17
Family ABC transporter ATPase domain-like 0.039
Further Details:      
 
Domain Number 2 Region: 18-113,156-269
Classification Level Classification E-value
Superfamily PHP domain-like 0.000000000667
Family PHP domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302595334|ref|YP_003829049.1|NC_014382
Sequence length 906
Comment ATPase [Escherichia coli plasmid pEC_B24]
Sequence
MIIRKTSYYEGTSVKGSEWNKWDLHIHSPMTWQANGYSSQCDIEHYVHLLREKQLSLIAV
TNYFYFRQNELETIREEIARQGLNITVLGNVEFRLDQQNKAGDFINVHILFSDKVSTERI
NEALARVPLRLTDGDRKAIYCCEKSVTESGHGVDTIVVDFSALLGHLSSAFRPFKDYLVA
VCPNGYGGYRPDASGRSAAIATEIDRQGQIIFGGKGDREFFLRTNRYDGASIKPVFLCSD
AHRVEDIGSRYTWVKALPTFEGLRQALLEPEDRLRLGDEWLTELTPKTHFSQIDLEGTIF
DGQEIRFKKLSIPLNQDMVAIIGGRGTGKSLLLDALRSRFAGTATRGSEQREVNVQYLSI
ELDKANGEKMRFDAPSEGYEYLHVSQGEIKKLCQEPGLISDEIKKMLRLTPIHEAGDTVA
QLAENLNIWRAWREFSLYRNEHSEPVNTRKFQQQIIRGAQEKIEVLTSDRNKALIETFRE
NSRRQTLLVQMRDKLTGVRADITTAENNLNASIAAINASVTTKEAIPLVDLSAQTEAVAC
RLLSIQEQTTQFGRDNDEIIGTFREQGLGQDITGLLEKVHEYQRQMELAETHLHEIERRE
RQYQTGLEQRAKVAAEFIDGLLSRQSVIDTAFASLTTKPHLTQDQQTLIKDILTDIRIYG
KPHFDIKAFYEGMLSCLNRGRFRASGELTSVDRLRQVFRVGSIDDFRALLANKPMLVLPE
FSNRKVTIEEFLWCDEYFNSPGPDSLLSYLFSPEQIQRYLNVRAEFEYKGKTVEKLSAGQ
RGTFYVCLKLATDAFGSPFVFDQPEDDLDNDFIMHSLVPLFRKIKQYRQVIIVTHNANLV
VNCDAEQVIIATNNDEIISYRSGALEYGDHDAPNSMRKAICDVLEGGHQAFEAREQKYGM
LWLKTI
Download sequence
Identical sequences D9Z4Z3
gi|302595334|ref|YP_003829049.1|NC_014382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]