SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|331271124|ref|YP_004385833.1|NC_015418 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331271124|ref|YP_004385833.1|NC_015418
Domain Number 1 Region: 20-622
Classification Level Classification E-value
Superfamily Anthrax protective antigen 9.15e-183
Family Anthrax protective antigen 0.0000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331271124|ref|YP_004385833.1|NC_015418
Sequence length 725
Comment C2 toxin, component II [Clostridium botulinum BKT015925 plasmid p3BKT015925]
Sequence
MLVSKIENSVKDSNKNYFTINGLMGYYFENDFFNLNIISPTLDGNLTFSKEDINSILGDK
SIKSARWIGLIKPSITGEYILSTNSPNCRVELNGEIFNLSLNTSNTVNLIQGNVYDIRIE
QLMSENQLLKNYEGIKLYWETSDIIKEIIPSEVLLKPNYSNTNQKSKFIPNNTLFSNAKL
KANANKDTDSDGIPDEWEVNGYTVMNQKAVAWDDKFAANGYKKYVSNPFKPSTANDPYTD
FEKVSGQIDPSVSTVARDPMISAYPIVGVQMERLVVSKSETITVDSTKSMSKSTSYSSTN
INTVGAEISGNLELAGGIFPVFNMSASANYSHTLENTSTVDNTTGESFSQGLSINTGESA
YINPNIRYYNTGTAPVYNVTPNTTIVIDKQSVATIKGQESLIGDYLNPSGTYPIIGQPPI
ALNTMDQSSSRLIPINYNQLKSIDNGGTVMLSTSQFTGNFAKYNSSGNLVTDGNNWEPYL
GTIKSTTVSLTLSFPDQTTQVAVAVVTPNFSDPEDRTPRLTLEQALVKAFGLEKKNDKFY
FQGIEITENQKIQVFLDNNTNIDFQNQLKNTADKDIMHCIIKRNMNILVKVITFKENISS
INIINDTNFGIQSMTGLSKRSKGQDGIYRASTKSFSFRTKKINHSRGYYKIRFVVQCSSS
FTCNFQLFNNQIFSRSFHEGFFDEFAYFKYDGSNSFLDISCNIIGHSNSGVFLVEVTRIG
DLIQI
Download sequence
Identical sequences gi|331271124|ref|YP_004385833.1| WP_013721000.1.85307 gi|331271124|ref|YP_004385833.1|NC_015418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]