SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385831900|ref|YP_005867335.1|NC_017483 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385831900|ref|YP_005867335.1|NC_017483
Domain Number 1 Region: 285-430,703-783
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000632
Family ABC transporter ATPase domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 10-107,138-251
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000128
Family PHP domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|385831900|ref|YP_005867335.1|NC_017483
Domain Number - Region: 282-338,511-666
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0181
Family Extended AAA-ATPase domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385831900|ref|YP_005867335.1|NC_017483
Sequence length 846
Comment DNA repair ATPase [Lactococcus lactis subsp. lactis CV56 plasmid pCV56A]
Sequence
MNKNRGSQFRKWDLHLHSLYSHSQLSNQYNINEYNHEERFDEFLKKLNENDIKAIGLTNY
FNFSEQDYCLKRKLEEKGIVVFLNLELRLENGNVKDETCDIHIIFDNLLDEKEVKCFLAS
MPAKVVDKRLNSISSKDDYKKAVVNFDDLVKCLNDKSLNLKNRYMIGILSRGKGSSRLSS
VFEDIAERCDFFIHSSDKQKNIEEDKEYLNSHGKPLLQSSDAHSFEKIGGKYSWIKADLN
FEGLRQIMFEPSERISLGKDNPDTKLDYQVIDSIELSDTRIIYLNSSLNTVIGGRSTGKS
TLTNAIAKALGNENFVPINEKTEKGMHVFDKDIIIHWRDGQEHQDLEFLPQNYMIEIAEK
DILRNNLVRSTVKSDEGNYRKIEKYEEDTRKNQNEIDNSIQEWSNLKDKLATLIKPEGDK
KGIEVQLQKLKEQISEQEKKSDFSERKSEEYRKSETELKYYLNHQRLSEINIRNLNDMGS
IEISLSTPIPSSDDTKFRESLEEYIEVLKTEVNEKWQQKIKELTDEQNEIFFENKLKVNE
IWNSEIFKQGQTNISNNETLRKLIEIQKQEQLKLDTFNKYENNKEKIETQINEIQTKILR
SYAKFGTLREKLQNEFEVKATPVEIKINFQPIKFEEKIKYLNGRNTTNNNFIEEFDKDSF
RKIDNIFDALNLSYNQGKSQNDLIKDVLSQHWYTINYNLQYDGDNFDQMSQGKKAFVVLT
LILEFSKDKKPVIIDQPEDSLDNRAIYNDLTNYLKEKKKERQIILVTHNPNIVVGADAEN
VIVANQHSEDSPNTHGIQFDYTNGSLENTYTKDVKYTLEKQGIREHVVEILEGGKEAFEK
REKKYK
Download sequence
Identical sequences A0A1V0NCH9
gi|385831900|ref|YP_005867335.1| gi|385831900|ref|YP_005867335.1|NC_017483 WP_014570260.1.8561 WP_014570260.1.96756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]