SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407703092|ref|YP_006816240.1|NC_018689 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|407703092|ref|YP_006816240.1|NC_018689
Domain Number - Region: 9-75
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0596
Family Coronavirus S2 glycoprotein 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407703092|ref|YP_006816240.1|NC_018689
Sequence length 100
Comment hypothetical protein MC28_G268 [Bacillus thuringiensis MC28 plasmid pMC429]
Sequence
MENKEILLAITELKSSIDKRFDALEKQFDKRLDSVSEELYKIKQNLVTVDGQQSEDTQKQ
IDKIEKDIKILNQDVMFLAGKLGVHDLKLIGIENKTYIKR
Download sequence
Identical sequences K0G194
gi|407703092|ref|YP_006816240.1| gi|407703092|ref|YP_006816240.1|NC_018689 WP_000428112.1.11380 WP_000428112.1.24992 WP_000428112.1.499 WP_000428112.1.64770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]