SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314730|ref|YP_007125653.1|NC_019743 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428314730|ref|YP_007125653.1|NC_019743
Domain Number - Region: 215-246
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0262
Family KorB DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428314730|ref|YP_007125653.1|NC_019743
Sequence length 419
Comment hypothetical protein Mic7113_6823 [Microcoleus sp. PCC 7113 plasmid pMIC7113.08]
Sequence
MYQLLALPYLSLSADILSRFTVRIHSRIVEKGRPWVRLWYFCRAFDQDGSGYLRLPILTI
SQLLEAAPSSIYQWLREGKAAGAFRWWKCQRGKLRVALGGLFAVCRDLISDSDSGKQRHA
PWGTPSEVGLHEILTLQKLRAAATVATTQRLQQLSRFAAWRKLPGPARKIYKLPQPDAFF
PSEEAQRLSDNHAKGSIRCVIHIGKRRVWTSRGFIPFGVSQQTIANERGIADRTVRRHLA
LMNVDRRQVVQSKSEYKLAADCLHHDGGAVEPSEDVNLRSSVDGSYYLSEKGLGGYNTIK
VGEVGFHRISSRFFTYGAKPKVWLYRCNIYQPRAKLCTMSSRRSEYRRLSGAHSAPTAML
PPLCQPLNVSLGDLLAEAGGHTTTFSRRGGVTSCNRPLNSFENSDRIDAIPAEKEGHFS
Download sequence
Identical sequences K9WPR2
gi|428314730|ref|YP_007125653.1| gi|428314730|ref|YP_007125653.1|NC_019743 WP_015186370.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]