SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|554651939|ref|YP_008719583.1|NC_022609 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|554651939|ref|YP_008719583.1|NC_022609
Domain Number 1 Region: 315-495,622-735,779-870
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.08e-22
Family ABC transporter ATPase domain-like 0.047
Further Details:      
 
Domain Number 2 Region: 9-106,198-282
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000863
Family PHP domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|554651939|ref|YP_008719583.1|NC_022609
Sequence length 934
Comment putative DNA repair ATPase [Klebsiella pneumoniae plasmid pKp11-42]
Sequence
MKLFPNGSEWRKWDLHVHTPSSSLENQYRNDWEAYLSAIEAFGDEVAVMGATDYCTISGY
EKLLAYRAQGRIANIEAVFPNIEFRITPETQKDKGVNIHLIVNPADAGHVDKIKHALGRL
HFRYCGQNYSCSDQQLTELGIAVAGLSSPEKNLRDGINQFKPSFDVFEDWLRSETWLRNN
VIVIASNSSGDGISGLRDNGLLAVRQNIYHLVDAIFSGNPQDCEYFQGRGSDSRADVISK
YGKLLPCLHGSDAHGLTKIFRPDGDRFCWIKADPTFAGLKQVLYDHTRVRIQKTSPHTKT
PYQYIKHVCFTDRSGHALFSDQPVNFSPDLNAIIGGKSSGKSLLLYHMACAINADEVSEK
IRISGQAAYDDFSNLDVEVTWGNGEVSSLHGDDCRPVTYIPQLYINHLAERSGQLQLNQL
VEEILYQNNNFKAFAVENTAQREATIRVIKTRIDYLTELRKKYSECGKEMEKYGTEKAVS
DEIRRQEEKIAQLRKQASFTPDEEKQYMALRLRTDNLQSRRRAIEDLTDASRSLKESLYR
HAGSTIQSLTDQLRLDIPLSENSSFLEKSLRQLEASLSAAVSDFIGRHEARFGCIPARLR
RIDTESAAKKETLLPLSVKITDQETLKASMAALEKEREKLRQLQQLSERRRSILQEGNDT
KNQLQTEYARLTDLYQAYVDELSKPEYHPEGEISVIARISFNAEKFDRFTGCFDRRGNIN
LLLGDLASPKGGYTFSADSHADTIAGIYDRYRSGGVAPALRKGIEDSDILSYLYDDCYLI
DFSVRYRNDDIVQMSPGKRGLVLLNLILHLSNSRHPILIDQPEDNLDNRTIYSQLNDFVR
LRKADRQIIMVTHNANLVVGTDAECVIVSNQSGQRSGIENSEFRFEYYTGSLECSFTSQD
DSGRLHTRGIREHVCEILEGGIQAFKERERKYGL
Download sequence
Identical sequences A0A142I4L0 A0A223UJX3 U5N349 W0FKC1
WP_001568022.1.100788 WP_001568022.1.101854 WP_001568022.1.102075 WP_001568022.1.10710 WP_001568022.1.10889 WP_001568022.1.11675 WP_001568022.1.1226 WP_001568022.1.13594 WP_001568022.1.18176 WP_001568022.1.19888 WP_001568022.1.21799 WP_001568022.1.21813 WP_001568022.1.21869 WP_001568022.1.21968 WP_001568022.1.22756 WP_001568022.1.24919 WP_001568022.1.26475 WP_001568022.1.27006 WP_001568022.1.29466 WP_001568022.1.29583 WP_001568022.1.29726 WP_001568022.1.30638 WP_001568022.1.31630 WP_001568022.1.31846 WP_001568022.1.34696 WP_001568022.1.34706 WP_001568022.1.36402 WP_001568022.1.38089 WP_001568022.1.38189 WP_001568022.1.4032 WP_001568022.1.40967 WP_001568022.1.42951 WP_001568022.1.43043 WP_001568022.1.43063 WP_001568022.1.46561 WP_001568022.1.51343 WP_001568022.1.51922 WP_001568022.1.53238 WP_001568022.1.54591 WP_001568022.1.55869 WP_001568022.1.57239 WP_001568022.1.58631 WP_001568022.1.58914 WP_001568022.1.59042 WP_001568022.1.59729 WP_001568022.1.60830 WP_001568022.1.62278 WP_001568022.1.62294 WP_001568022.1.62373 WP_001568022.1.62783 WP_001568022.1.65042 WP_001568022.1.65043 WP_001568022.1.66292 WP_001568022.1.66670 WP_001568022.1.66719 WP_001568022.1.70492 WP_001568022.1.71625 WP_001568022.1.72763 WP_001568022.1.72955 WP_001568022.1.74357 WP_001568022.1.75115 WP_001568022.1.75719 WP_001568022.1.77076 WP_001568022.1.77307 WP_001568022.1.77723 WP_001568022.1.80217 WP_001568022.1.8186 WP_001568022.1.83691 WP_001568022.1.84128 WP_001568022.1.87402 WP_001568022.1.88419 WP_001568022.1.89117 WP_001568022.1.90877 WP_001568022.1.91323 WP_001568022.1.91613 WP_001568022.1.93058 WP_001568022.1.93509 WP_001568022.1.9353 WP_001568022.1.94956 WP_001568022.1.95299 WP_001568022.1.96009 WP_001568022.1.97273 WP_001568022.1.98184 WP_001568022.1.98311 WP_001568022.1.98320 WP_001568022.1.99035 WP_001568022.1.99264 gi|554651939|ref|YP_008719583.1|NC_022609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]