SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78045446|ref|YP_361696.1|NC_007507 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78045446|ref|YP_361696.1|NC_007507
Domain Number 1 Region: 98-240
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.15e-35
Family DsbC/DsbG C-terminal domain-like 0.0000811
Further Details:      
 
Domain Number 2 Region: 40-89
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.0000000105
Family DsbC/DsbG N-terminal domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78045446|ref|YP_361696.1|NC_007507
Sequence length 250
Comment thiol:disulfide interchange protein [Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid pXCV183]
Sequence
MNRLALPLLLTLSLAACGDDSTPNASSGLDLAQAAVSKLAPHAKVTGVERAAVPGLLQVT
VDGSQVIYISENGQHLLAGQIIELASKDNLTERATSALHRKMLAELPPERKIVYAAEDPK
HTVTVFTDVDCGYCRMLHEHIPDYNKAGISIEYVLYPRSGLQSPTYATSVSVWCAQDRKQ
ALIAVSTGGELTPAQCTNPVAEDYALGQRLGVTATPAIFAEDGRQVGGLLPPAQLLAVLD
GRAQRGPTQP
Download sequence
Identical sequences Q3BZW7
gi|78045446|ref|YP_361696.1|NC_007507 WP_011345733.1.100156 WP_011345733.1.13735 WP_011345733.1.27112 WP_011345733.1.40690 WP_011345733.1.46677 WP_011345733.1.60785 WP_011345733.1.89212 gi|78045446|ref|YP_361696.1| 316273.XCVd0137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]