SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94313617|ref|YP_586826.1|NC_007974 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94313617|ref|YP_586826.1|NC_007974
Domain Number 1 Region: 80-232
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.06e-32
Family Glutathione peroxidase-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94313617|ref|YP_586826.1|NC_007974
Sequence length 235
Comment Sco1/SenC family protein [Cupriavidus metallidurans CH34 plasmid megaplasmid]
Sequence
MPPLALLAHNGVNTRQGARQRNVEEGTPMKAYAKRWSKVAAVTAVGLIVCVSMGAVGHES
DDPHSHHEMKREMHTSTVDYRLPPVTLVRDDGQAVSLANELDDGRPVVLTFIYTTCTSIC
PVISQTLSQLQAELGPDRDKVHLVSISIDPEHDTPGRLREYAAKFGAGPEWQHYTGAVSA
SVAAQKAFNVYHEDKMNHSPVVLLRAAPGKPWLRIDGFATADEILHAYHHLMASN
Download sequence
Identical sequences A0A132H9W6 Q1LE69
gi|94313617|ref|YP_586826.1| 266264.Rmet_4695 gi|94313617|ref|YP_586826.1|NC_007974 WP_011519128.1.12480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]