SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15601876|ref|NP_244948.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601876|ref|NP_244948.1|
Domain Number 1 Region: 48-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.38e-35
Family Glutathione peroxidase-like 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15601876|ref|NP_244948.1|
Sequence length 181
Comment protein DsbE [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNKKLYFPLILFLILVFAFAVQLLRNAQGDDPKALESALIGKPVPLRTLQDLFEEKQYGI
EIFQQGKPILLNVWATWCPTCYAEHQYLNKLAQQGVTIIGIDYKDKSAQAIKWLKDLGNP
YQIVLKDEKGSNGLDLGVYGAPETFVIDGQGIIHYRHAGDLNQKVWDEKIQPIYQKLVER
K
Download sequence
Identical sequences A0A290LPZ0 Q9CPM6
272843.PM0011 WP_005722249.1.12311 WP_005722249.1.14908 WP_005722249.1.15732 WP_005722249.1.19996 WP_005722249.1.24757 WP_005722249.1.26777 WP_005722249.1.3957 WP_005722249.1.40210 WP_005722249.1.40787 WP_005722249.1.41351 WP_005722249.1.41667 WP_005722249.1.45422 WP_005722249.1.4808 WP_005722249.1.53852 WP_005722249.1.58111 WP_005722249.1.61098 WP_005722249.1.6219 WP_005722249.1.62389 WP_005722249.1.66990 WP_005722249.1.70689 WP_005722249.1.81885 WP_005722249.1.8281 WP_005722249.1.88402 WP_005722249.1.89773 WP_005722249.1.92478 WP_005722249.1.93940 WP_005722249.1.9746 WP_005722249.1.9947 gi|15601876|ref|NP_244948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]