SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15601893|ref|NP_244965.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601893|ref|NP_244965.1|
Domain Number 1 Region: 16-169
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.36e-30
Family Glutathione peroxidase-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15601893|ref|NP_244965.1|
Sequence length 188
Comment protein DsbE [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSMLHQQKRKNHFVFLPLVILLAVCALLFIGLQQDPQKIASALIGKPVPTFSQADLLRTE
RRVTQQDLPQQTFLLNVWGSWCAYCKKEHPFLMQLAKSMPIVGLNYRDNPQNALAMLNQL
GNPFQLVINDSRGELALNLGVDGAPETYLIDQYGVIRYRYSGPLTPEVWQEMFIPEWQKL
EAENAKVR
Download sequence
Identical sequences A0A1E3XLQ8 Q9CPK9 V4MVJ5
gi|378774907|ref|YP_005177150.1| gi|386834925|ref|YP_006240242.1| gi|383310879|ref|YP_005363689.1| gi|15601893|ref|NP_244965.1| WP_005721368.1.10027 WP_005721368.1.10721 WP_005721368.1.12156 WP_005721368.1.12311 WP_005721368.1.1307 WP_005721368.1.15732 WP_005721368.1.17217 WP_005721368.1.17980 WP_005721368.1.18123 WP_005721368.1.19996 WP_005721368.1.20287 WP_005721368.1.22153 WP_005721368.1.2313 WP_005721368.1.23830 WP_005721368.1.24757 WP_005721368.1.26616 WP_005721368.1.26777 WP_005721368.1.27416 WP_005721368.1.27592 WP_005721368.1.29697 WP_005721368.1.30617 WP_005721368.1.34253 WP_005721368.1.35978 WP_005721368.1.36022 WP_005721368.1.38246 WP_005721368.1.3839 WP_005721368.1.39152 WP_005721368.1.40210 WP_005721368.1.40787 WP_005721368.1.41297 WP_005721368.1.41351 WP_005721368.1.41462 WP_005721368.1.41657 WP_005721368.1.41667 WP_005721368.1.42512 WP_005721368.1.42943 WP_005721368.1.44741 WP_005721368.1.45422 WP_005721368.1.47685 WP_005721368.1.4808 WP_005721368.1.49053 WP_005721368.1.50853 WP_005721368.1.52066 WP_005721368.1.52585 WP_005721368.1.52859 WP_005721368.1.53852 WP_005721368.1.55401 WP_005721368.1.57420 WP_005721368.1.57956 WP_005721368.1.58111 WP_005721368.1.58257 WP_005721368.1.58450 WP_005721368.1.58628 WP_005721368.1.58910 WP_005721368.1.59455 WP_005721368.1.60664 WP_005721368.1.61860 WP_005721368.1.62016 WP_005721368.1.6219 WP_005721368.1.62389 WP_005721368.1.65482 WP_005721368.1.65878 WP_005721368.1.66934 WP_005721368.1.66990 WP_005721368.1.70689 WP_005721368.1.73917 WP_005721368.1.74955 WP_005721368.1.75804 WP_005721368.1.79347 WP_005721368.1.79593 WP_005721368.1.80223 WP_005721368.1.80589 WP_005721368.1.80911 WP_005721368.1.81885 WP_005721368.1.8281 WP_005721368.1.83579 WP_005721368.1.86541 WP_005721368.1.87897 WP_005721368.1.88402 WP_005721368.1.89773 WP_005721368.1.90081 WP_005721368.1.90179 WP_005721368.1.91495 WP_005721368.1.92478 WP_005721368.1.93940 WP_005721368.1.94432 WP_005721368.1.94435 WP_005721368.1.95718 WP_005721368.1.9746 WP_005721368.1.9947 272843.PM0028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]