SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602056|ref|NP_245128.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602056|ref|NP_245128.1|
Domain Number 1 Region: 85-225
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.06e-35
Family DsbC/DsbG C-terminal domain-like 0.00000191
Further Details:      
 
Domain Number 2 Region: 22-76
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.0000000000000419
Family DsbC/DsbG N-terminal domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602056|ref|NP_245128.1|
Sequence length 227
Comment protein DsbC [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKILSTLLMLGMSSLTFANSQQVVEQLQKMGLSGVEVSDSPVKGIKTAVTDNGIFYITE
DAKYILDGKLYALSEKGLRDVSSSLLLDKLTAYKNEMVVYPAKDEKHVITVFMDTSCHYC
KVLHKQIKEYNDLGITVRYLAFPRGGVQSKTAREMEAIFTAQDPQFALTEAINGNPPKTL
KDANITKKHYQLGLQFGVNGTPSIVTEKGELIGGYLKPADLLSELAQ
Download sequence
Identical sequences A0A1E3XK33 A0A2K2YY77 Q9CP65 V4N7U4
272843.PM0191 gi|15602056|ref|NP_245128.1| gi|386834703|ref|YP_006240020.1| gi|383310712|ref|YP_005363522.1| gi|378774740|ref|YP_005176983.1| WP_005756009.1.10027 WP_005756009.1.10721 WP_005756009.1.11014 WP_005756009.1.12311 WP_005756009.1.1307 WP_005756009.1.14908 WP_005756009.1.15732 WP_005756009.1.17217 WP_005756009.1.17980 WP_005756009.1.18123 WP_005756009.1.19996 WP_005756009.1.20287 WP_005756009.1.21657 WP_005756009.1.22153 WP_005756009.1.2313 WP_005756009.1.23830 WP_005756009.1.24757 WP_005756009.1.26616 WP_005756009.1.26777 WP_005756009.1.27416 WP_005756009.1.27592 WP_005756009.1.27664 WP_005756009.1.29697 WP_005756009.1.30617 WP_005756009.1.34253 WP_005756009.1.35978 WP_005756009.1.36022 WP_005756009.1.39152 WP_005756009.1.3957 WP_005756009.1.40210 WP_005756009.1.40787 WP_005756009.1.41297 WP_005756009.1.41351 WP_005756009.1.41462 WP_005756009.1.41657 WP_005756009.1.41667 WP_005756009.1.42469 WP_005756009.1.42512 WP_005756009.1.42943 WP_005756009.1.44741 WP_005756009.1.45422 WP_005756009.1.47685 WP_005756009.1.4808 WP_005756009.1.50853 WP_005756009.1.51342 WP_005756009.1.52066 WP_005756009.1.53852 WP_005756009.1.55074 WP_005756009.1.57420 WP_005756009.1.57956 WP_005756009.1.58111 WP_005756009.1.58450 WP_005756009.1.58628 WP_005756009.1.58910 WP_005756009.1.59455 WP_005756009.1.60664 WP_005756009.1.61098 WP_005756009.1.61860 WP_005756009.1.62016 WP_005756009.1.6219 WP_005756009.1.62389 WP_005756009.1.65482 WP_005756009.1.65878 WP_005756009.1.66934 WP_005756009.1.66990 WP_005756009.1.70689 WP_005756009.1.73917 WP_005756009.1.74955 WP_005756009.1.75804 WP_005756009.1.80223 WP_005756009.1.80589 WP_005756009.1.80911 WP_005756009.1.81885 WP_005756009.1.8281 WP_005756009.1.86541 WP_005756009.1.87897 WP_005756009.1.88402 WP_005756009.1.89773 WP_005756009.1.90081 WP_005756009.1.90179 WP_005756009.1.90578 WP_005756009.1.91495 WP_005756009.1.92478 WP_005756009.1.93940 WP_005756009.1.94432 WP_005756009.1.94435 WP_005756009.1.95718 WP_005756009.1.9746 WP_005756009.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]