SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602058|ref|NP_245130.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602058|ref|NP_245130.1|
Domain Number 1 Region: 36-219
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.43e-24
Family DsbA-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602058|ref|NP_245130.1|
Sequence length 224
Comment hypothetical protein PM0193 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTMWRIGSLFLFVWSVAQCALATPISVSSYSDKSPLFLEGRDYFSYQEPVYQANPSEPIL
IQFFFDYDCRVCSSALDILELYSQINFDKVVLKELPIAAEKAHYSALIFYALKEIQAEDI
SALLLFETADKHRYGQLSRFHDLRLWLDGQGVNTDDFTKALYSVKVAKAVEQAEKLTEEY
GVFTFPYVVIDGRYVLTASTLYSDDYSFAVLDFLVSKLMKEKQK
Download sequence
Identical sequences Q9CP63
gi|15602058|ref|NP_245130.1| 272843.PM0193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]