SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602086|ref|NP_245158.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602086|ref|NP_245158.1|
Domain Number 1 Region: 35-146
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 1.44e-36
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.0000595
Further Details:      
 
Domain Number 2 Region: 465-577
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-22
Family Thioltransferase 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602086|ref|NP_245158.1|
Sequence length 586
Comment thiol:disulfide interchange protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLSWNDMVLLMKKIFFIFFLIWTSLSVNAGVFDKKNAFLKAEQAFVFTESQQNDRLSLNW
DIASGYYLYKKSLEIKGENGQLFIPQLPLAEIHQDDFFGDVEIYRHQLTFSLPFTQLSAT
KQVEITYQGCTEGFCYPPETRVIALTSLERESGQISSAVLKEESVLSELPLAEQDRLAAK
LIESKYAVFWFFLFGLGLAFTPCVLPMLPLLSAIVIGREQRPSTAKAFGLSVVYVQGMAL
TYTLLGLIVAAIGLPFQVALQSPYVLLTLSAIFVLLALSMFGLFTLQLPVSLQTKLTQYS
QQQKSGVFGGVFVMGMIAGLVASPCTSAPLSGALLYVAQSGDLFTGAITLYLLALGMGLP
LIFITVFGNNILPKSGNWMIQVKNAFGFVLLALPIFLISRVFPEIEMPLWFSLAFAFSLW
LLYQFRNNKGVWVFTFILGVMGYLYYSYAMNRHTPAHQTTSLSQFERITSYAQLQQVLSK
NPNSLAMLDLYADWCVACKEFETHTFSDVAVQKAFTDVLLLQVDMTKNSEANRELMQKLH
VIGLPTLIFFNQQGQEIEGSRITGFMQASPFVDWLQKMKSIQPISQ
Download sequence
Identical sequences gi|15602086|ref|NP_245158.1| 272843.PM0221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]