SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602660|ref|NP_245732.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602660|ref|NP_245732.1|
Domain Number 1 Region: 1-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.48e-66
Family Glutathione peroxidase-like 0.00000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602660|ref|NP_245732.1|
Sequence length 200
Comment protein TsaA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MVLVTRQAPDFTAAAVLGNGEIVDNFNFKQHIAGKAAVVFFYPLDFTFVCPSELIAFDHR
YEEFQKRGVEVVGISIDSEFSHNAWRKTPVENGGIGEVKYALVADIKHEIAQAFGIEHPE
AGVALRASFLIDKDGVVRHQVVNDLPLGRNIDEMLRMVDALQFHEEHGDVCPAQWEKGKE
GMTGSPEGVAKYLKQHADQL
Download sequence
Identical sequences A0A1E3XKK1 A0A2K2Z0F0 Q9CMM3 V4PWC4
WP_005716614.1.10027 WP_005716614.1.10721 WP_005716614.1.11014 WP_005716614.1.11214 WP_005716614.1.11947 WP_005716614.1.12156 WP_005716614.1.12311 WP_005716614.1.1307 WP_005716614.1.15732 WP_005716614.1.17217 WP_005716614.1.17980 WP_005716614.1.18123 WP_005716614.1.19996 WP_005716614.1.20287 WP_005716614.1.21657 WP_005716614.1.22153 WP_005716614.1.2313 WP_005716614.1.23830 WP_005716614.1.24757 WP_005716614.1.26616 WP_005716614.1.26777 WP_005716614.1.27416 WP_005716614.1.27592 WP_005716614.1.27664 WP_005716614.1.28084 WP_005716614.1.29697 WP_005716614.1.30617 WP_005716614.1.34253 WP_005716614.1.35562 WP_005716614.1.35978 WP_005716614.1.36022 WP_005716614.1.3807 WP_005716614.1.38246 WP_005716614.1.3839 WP_005716614.1.39152 WP_005716614.1.40210 WP_005716614.1.40787 WP_005716614.1.41297 WP_005716614.1.41351 WP_005716614.1.41462 WP_005716614.1.41657 WP_005716614.1.41667 WP_005716614.1.4211 WP_005716614.1.42469 WP_005716614.1.42512 WP_005716614.1.42943 WP_005716614.1.43687 WP_005716614.1.44741 WP_005716614.1.45422 WP_005716614.1.47685 WP_005716614.1.4808 WP_005716614.1.49053 WP_005716614.1.50853 WP_005716614.1.51342 WP_005716614.1.52066 WP_005716614.1.52585 WP_005716614.1.52859 WP_005716614.1.53852 WP_005716614.1.55074 WP_005716614.1.55401 WP_005716614.1.57420 WP_005716614.1.57956 WP_005716614.1.58111 WP_005716614.1.58257 WP_005716614.1.58450 WP_005716614.1.58628 WP_005716614.1.58910 WP_005716614.1.59455 WP_005716614.1.60478 WP_005716614.1.60664 WP_005716614.1.61860 WP_005716614.1.62016 WP_005716614.1.6219 WP_005716614.1.62389 WP_005716614.1.6332 WP_005716614.1.63549 WP_005716614.1.65482 WP_005716614.1.65878 WP_005716614.1.66934 WP_005716614.1.66990 WP_005716614.1.70689 WP_005716614.1.72215 WP_005716614.1.73917 WP_005716614.1.74955 WP_005716614.1.75804 WP_005716614.1.78987 WP_005716614.1.79347 WP_005716614.1.79593 WP_005716614.1.80223 WP_005716614.1.80589 WP_005716614.1.80911 WP_005716614.1.81885 WP_005716614.1.8281 WP_005716614.1.83579 WP_005716614.1.86541 WP_005716614.1.87897 WP_005716614.1.88402 WP_005716614.1.89773 WP_005716614.1.90081 WP_005716614.1.90179 WP_005716614.1.90578 WP_005716614.1.91495 WP_005716614.1.92478 WP_005716614.1.93940 WP_005716614.1.94432 WP_005716614.1.94435 WP_005716614.1.95718 WP_005716614.1.9746 WP_005716614.1.9947 gi|15602660|ref|NP_245732.1| gi|386834055|ref|YP_006239370.1| gi|378774505|ref|YP_005176748.1| 272843.PM0795 gi|383310475|ref|YP_005363285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]