SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602685|ref|NP_245757.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602685|ref|NP_245757.1|
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.58e-40
Family Glutathione peroxidase-like 0.000000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602685|ref|NP_245757.1|
Sequence length 165
Comment thiol peroxidase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSKITLAGTEIEVSGVFPQVGDVVTDFTTVSAKLEDTTLANFAGKRKILNIFPSIDTGIC
ATSVRKFNEQAAKLANTAVLCLSTDLPFAQARFCGAEGLENVFTVSTFRNKDVHKQLGVD
IVEGPLAGLTARAVIVLDENNRVLHSELVPEIKQEPNYDAALAVL
Download sequence
Identical sequences P57880
272843.PM0820 gi|15602685|ref|NP_245757.1| WP_010906866.1.12311 WP_010906866.1.15732 WP_010906866.1.19996 WP_010906866.1.40210 WP_010906866.1.45422 WP_010906866.1.4808 WP_010906866.1.53852 WP_010906866.1.6219 WP_010906866.1.62389 WP_010906866.1.66990 WP_010906866.1.81885 WP_010906866.1.8281 WP_010906866.1.89773 WP_010906866.1.9746 WP_010906866.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]