SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602692|ref|NP_245764.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602692|ref|NP_245764.1|
Domain Number 1 Region: 3-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.43e-19
Family Thioltransferase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602692|ref|NP_245764.1|
Sequence length 87
Comment glutaredoxin [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MFVVIFGRAGCPYCVRAKNLADKLKQSLPDFDYRYVDIVAEGISKADLSKSVGKPVETVP
QIFIDEKPIGGCTDFEALMKAQFNIVA
Download sequence
Identical sequences A0A1E3XLV9 A0A2K2Z0Y5 Q9CMJ7 V4N7N1
WP_005716684.1.10027 WP_005716684.1.10721 WP_005716684.1.11014 WP_005716684.1.12311 WP_005716684.1.1307 WP_005716684.1.14908 WP_005716684.1.15732 WP_005716684.1.17217 WP_005716684.1.17980 WP_005716684.1.18123 WP_005716684.1.19996 WP_005716684.1.20287 WP_005716684.1.21657 WP_005716684.1.22153 WP_005716684.1.2313 WP_005716684.1.23830 WP_005716684.1.24757 WP_005716684.1.26616 WP_005716684.1.26777 WP_005716684.1.27416 WP_005716684.1.27592 WP_005716684.1.27664 WP_005716684.1.29697 WP_005716684.1.30617 WP_005716684.1.34253 WP_005716684.1.35978 WP_005716684.1.36022 WP_005716684.1.39152 WP_005716684.1.3957 WP_005716684.1.40210 WP_005716684.1.40787 WP_005716684.1.41297 WP_005716684.1.41351 WP_005716684.1.41462 WP_005716684.1.41657 WP_005716684.1.41667 WP_005716684.1.4211 WP_005716684.1.42469 WP_005716684.1.42512 WP_005716684.1.42943 WP_005716684.1.44741 WP_005716684.1.45422 WP_005716684.1.47685 WP_005716684.1.4808 WP_005716684.1.50853 WP_005716684.1.51342 WP_005716684.1.52066 WP_005716684.1.53852 WP_005716684.1.55074 WP_005716684.1.57420 WP_005716684.1.57956 WP_005716684.1.58111 WP_005716684.1.58450 WP_005716684.1.58628 WP_005716684.1.58910 WP_005716684.1.59455 WP_005716684.1.60664 WP_005716684.1.61098 WP_005716684.1.61860 WP_005716684.1.62016 WP_005716684.1.6219 WP_005716684.1.62389 WP_005716684.1.65482 WP_005716684.1.65878 WP_005716684.1.66934 WP_005716684.1.66990 WP_005716684.1.70689 WP_005716684.1.73917 WP_005716684.1.74955 WP_005716684.1.75804 WP_005716684.1.79593 WP_005716684.1.80223 WP_005716684.1.80589 WP_005716684.1.80911 WP_005716684.1.81885 WP_005716684.1.8281 WP_005716684.1.86541 WP_005716684.1.87897 WP_005716684.1.88402 WP_005716684.1.89773 WP_005716684.1.90081 WP_005716684.1.90179 WP_005716684.1.90578 WP_005716684.1.91495 WP_005716684.1.92478 WP_005716684.1.93940 WP_005716684.1.94432 WP_005716684.1.94435 WP_005716684.1.95718 WP_005716684.1.9746 WP_005716684.1.9947 gi|383310510|ref|YP_005363320.1| 272843.PM0827 gi|15602692|ref|NP_245764.1| gi|378774539|ref|YP_005176782.1| gi|386834020|ref|YP_006239335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]