SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602859|ref|NP_245931.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602859|ref|NP_245931.1|
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.77e-40
Family Thioltransferase 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602859|ref|NP_245931.1|
Sequence length 106
Comment TrxM [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MEVLHSTDATFTADVVNSDVPVLLDFWAPWCGPCRMISPILDEIAAEFSGKVKVVKINID
ENQATPAQLGVRSIPTLVLFKNGKAVATQVGALPKNQLANFINQNI
Download sequence
Identical sequences A0A2J7XWP7 Q9CM49 V4MPX7
gi|15602859|ref|NP_245931.1| gi|386833837|ref|YP_006239151.1| gi|378773853|ref|YP_005176096.1| 272843.PM0994 WP_005717197.1.10027 WP_005717197.1.10721 WP_005717197.1.11014 WP_005717197.1.11214 WP_005717197.1.11947 WP_005717197.1.12156 WP_005717197.1.12311 WP_005717197.1.1307 WP_005717197.1.14908 WP_005717197.1.15732 WP_005717197.1.17217 WP_005717197.1.17980 WP_005717197.1.18123 WP_005717197.1.19996 WP_005717197.1.20287 WP_005717197.1.21657 WP_005717197.1.22153 WP_005717197.1.2313 WP_005717197.1.23830 WP_005717197.1.24757 WP_005717197.1.26616 WP_005717197.1.26777 WP_005717197.1.27416 WP_005717197.1.27592 WP_005717197.1.27664 WP_005717197.1.28084 WP_005717197.1.29697 WP_005717197.1.30617 WP_005717197.1.34253 WP_005717197.1.35562 WP_005717197.1.35978 WP_005717197.1.36022 WP_005717197.1.3807 WP_005717197.1.38246 WP_005717197.1.3839 WP_005717197.1.39152 WP_005717197.1.3957 WP_005717197.1.40210 WP_005717197.1.40787 WP_005717197.1.41351 WP_005717197.1.41462 WP_005717197.1.41657 WP_005717197.1.41667 WP_005717197.1.42469 WP_005717197.1.42512 WP_005717197.1.42943 WP_005717197.1.43687 WP_005717197.1.44741 WP_005717197.1.45422 WP_005717197.1.47685 WP_005717197.1.4808 WP_005717197.1.49053 WP_005717197.1.50853 WP_005717197.1.51342 WP_005717197.1.52066 WP_005717197.1.52585 WP_005717197.1.52859 WP_005717197.1.53852 WP_005717197.1.55074 WP_005717197.1.55401 WP_005717197.1.57420 WP_005717197.1.58111 WP_005717197.1.58257 WP_005717197.1.58450 WP_005717197.1.58628 WP_005717197.1.58910 WP_005717197.1.59455 WP_005717197.1.60478 WP_005717197.1.60664 WP_005717197.1.61098 WP_005717197.1.61860 WP_005717197.1.62016 WP_005717197.1.6219 WP_005717197.1.62389 WP_005717197.1.6332 WP_005717197.1.63549 WP_005717197.1.65482 WP_005717197.1.65878 WP_005717197.1.66934 WP_005717197.1.66990 WP_005717197.1.72215 WP_005717197.1.73917 WP_005717197.1.74955 WP_005717197.1.75804 WP_005717197.1.78987 WP_005717197.1.79347 WP_005717197.1.79593 WP_005717197.1.80223 WP_005717197.1.80589 WP_005717197.1.80911 WP_005717197.1.8281 WP_005717197.1.83579 WP_005717197.1.86541 WP_005717197.1.87897 WP_005717197.1.88402 WP_005717197.1.89773 WP_005717197.1.90081 WP_005717197.1.90179 WP_005717197.1.90578 WP_005717197.1.91495 WP_005717197.1.92478 WP_005717197.1.93940 WP_005717197.1.94432 WP_005717197.1.94435 WP_005717197.1.95718 WP_005717197.1.9746 WP_005717197.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]