SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602888|ref|NP_245960.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602888|ref|NP_245960.1|
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.33e-35
Family ArsC-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602888|ref|NP_245960.1|
Sequence length 114
Comment hypothetical protein PM1023 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MITVYGIKNCDTVKKALSWLSANNITHQLHDYRVDGLDKSWLAQAEAQFGWEVLVNKRST
TWRNLSDEVKENLSKQTALEVLFEQPTLIKRPIILQDGKALIGFNAKEYAACFK
Download sequence
Identical sequences A0A1D7R3F7 Q9CM21 V4N701
gi|383309826|ref|YP_005362636.1| 272843.PM1023 WP_005717328.1.10027 WP_005717328.1.10721 WP_005717328.1.12311 WP_005717328.1.1307 WP_005717328.1.14908 WP_005717328.1.15732 WP_005717328.1.17217 WP_005717328.1.18123 WP_005717328.1.19996 WP_005717328.1.20287 WP_005717328.1.21657 WP_005717328.1.22153 WP_005717328.1.2313 WP_005717328.1.23830 WP_005717328.1.26616 WP_005717328.1.26777 WP_005717328.1.27416 WP_005717328.1.29697 WP_005717328.1.30617 WP_005717328.1.34253 WP_005717328.1.35978 WP_005717328.1.39152 WP_005717328.1.3957 WP_005717328.1.40210 WP_005717328.1.41297 WP_005717328.1.41351 WP_005717328.1.41462 WP_005717328.1.41667 WP_005717328.1.42943 WP_005717328.1.44741 WP_005717328.1.45422 WP_005717328.1.47685 WP_005717328.1.4808 WP_005717328.1.50853 WP_005717328.1.51342 WP_005717328.1.52066 WP_005717328.1.53852 WP_005717328.1.55074 WP_005717328.1.57420 WP_005717328.1.57956 WP_005717328.1.58111 WP_005717328.1.58450 WP_005717328.1.58628 WP_005717328.1.58910 WP_005717328.1.59455 WP_005717328.1.60664 WP_005717328.1.61098 WP_005717328.1.61860 WP_005717328.1.62016 WP_005717328.1.6219 WP_005717328.1.62389 WP_005717328.1.65482 WP_005717328.1.65878 WP_005717328.1.66934 WP_005717328.1.66990 WP_005717328.1.73917 WP_005717328.1.74955 WP_005717328.1.75804 WP_005717328.1.80223 WP_005717328.1.80589 WP_005717328.1.80911 WP_005717328.1.81885 WP_005717328.1.8281 WP_005717328.1.86541 WP_005717328.1.87897 WP_005717328.1.88402 WP_005717328.1.89773 WP_005717328.1.90081 WP_005717328.1.90179 WP_005717328.1.91495 WP_005717328.1.92478 WP_005717328.1.93940 WP_005717328.1.94435 WP_005717328.1.9746 WP_005717328.1.9947 gi|15602888|ref|NP_245960.1| gi|378773824|ref|YP_005176067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]