SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15602917|ref|NP_245989.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602917|ref|NP_245989.1|
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-44
Family Glutathione peroxidase-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602917|ref|NP_245989.1|
Sequence length 155
Comment thioredoxin-dependent thiol peroxidase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKTLSIGESAPQFSLLNQCKENISLNQFAGKKVLVYFYPKALTPGCNTQACGLRDSKTEL
EKHGVVILGISPDSPEKLSKFSEKKALNFHLLADEDHQVAEQFGVWGEKKFLGKTYDGIH
RISFLIDEQGNVEQVFRQFKTSNHHQVVLDYLTQK
Download sequence
Identical sequences A0A1D7R3J0 Q9CLZ6 V4N728
gi|386833777|ref|YP_006239091.1| gi|15602917|ref|NP_245989.1| 272843.PM1052 WP_005751784.1.10027 WP_005751784.1.10721 WP_005751784.1.11214 WP_005751784.1.11947 WP_005751784.1.12156 WP_005751784.1.12311 WP_005751784.1.1307 WP_005751784.1.15732 WP_005751784.1.17217 WP_005751784.1.18123 WP_005751784.1.19996 WP_005751784.1.20287 WP_005751784.1.22153 WP_005751784.1.2313 WP_005751784.1.23830 WP_005751784.1.26616 WP_005751784.1.26777 WP_005751784.1.27416 WP_005751784.1.27592 WP_005751784.1.28084 WP_005751784.1.29697 WP_005751784.1.30617 WP_005751784.1.34253 WP_005751784.1.35562 WP_005751784.1.35978 WP_005751784.1.36022 WP_005751784.1.3807 WP_005751784.1.38246 WP_005751784.1.3839 WP_005751784.1.39152 WP_005751784.1.40210 WP_005751784.1.41462 WP_005751784.1.41657 WP_005751784.1.42512 WP_005751784.1.42943 WP_005751784.1.43687 WP_005751784.1.44741 WP_005751784.1.45422 WP_005751784.1.47685 WP_005751784.1.4808 WP_005751784.1.49053 WP_005751784.1.50853 WP_005751784.1.52066 WP_005751784.1.52585 WP_005751784.1.52859 WP_005751784.1.53852 WP_005751784.1.55401 WP_005751784.1.57420 WP_005751784.1.58257 WP_005751784.1.58450 WP_005751784.1.58628 WP_005751784.1.58910 WP_005751784.1.59455 WP_005751784.1.60478 WP_005751784.1.60664 WP_005751784.1.61860 WP_005751784.1.62016 WP_005751784.1.6219 WP_005751784.1.62389 WP_005751784.1.6332 WP_005751784.1.63549 WP_005751784.1.65482 WP_005751784.1.65878 WP_005751784.1.66934 WP_005751784.1.66990 WP_005751784.1.72215 WP_005751784.1.73917 WP_005751784.1.74955 WP_005751784.1.75804 WP_005751784.1.78987 WP_005751784.1.79347 WP_005751784.1.80223 WP_005751784.1.80589 WP_005751784.1.80911 WP_005751784.1.81885 WP_005751784.1.8281 WP_005751784.1.83579 WP_005751784.1.86541 WP_005751784.1.87897 WP_005751784.1.89773 WP_005751784.1.90081 WP_005751784.1.90179 WP_005751784.1.91495 WP_005751784.1.94432 WP_005751784.1.94435 WP_005751784.1.95718 WP_005751784.1.9746 WP_005751784.1.9947 gi|378773793|ref|YP_005176036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]